PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011088915.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family NAC
Protein Properties Length: 240aa    MW: 27519.2 Da    PI: 8.2084
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011088915.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM137.77.3e-4361381128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkk.leleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                     l+pG+rF Pt+eelv++yL++ +++++ +++ +vi+ +diy+++P++Lpk     +++++++w+fF++r+ ++ +g r++r+t+sgyWkatg+  
  XP_011088915.1   6 LQPGVRFYPTEEELVSFYLHNMLQHNNnNKIRRVIPLLDIYQLHPSQLPKhcgeLCRGDTEQWFFFVPRQAREVRGGRPSRTTASGYWKATGSPS 100
                     579********************99985677788***************645643444777********************************** PP

             NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      v+s++++++g+kk++vfy+g+ap g kt+W m+eyr+
  XP_011088915.1 101 YVYSSDNKVIGVKKSMVFYQGKAPAGAKTKWKMNEYRA 138
                     ************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.5E-465161IPR003441NAC domain
PROSITE profilePS5100544.5156162IPR003441NAC domain
PfamPF023651.0E-228137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MASEILQPGV RFYPTEEELV SFYLHNMLQH NNNNKIRRVI PLLDIYQLHP SQLPKHCGEL  60
CRGDTEQWFF FVPRQAREVR GGRPSRTTAS GYWKATGSPS YVYSSDNKVI GVKKSMVFYQ  120
GKAPAGAKTK WKMNEYRAIK EDFCTSIPVL RHEVSLCRVY VVSGSFRAFD RRPTHVAANS  180
ISKEVKIVQE NDKITLSTNE IAGMLQERSW YSYSEANHSV ENSSEMINGV EHLMECDEDV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-29616017163NAC domain-containing protein 19
4dul_A2e-29616017163NAC domain-containing protein 19
1ut7_B2e-29616017163NO APICAL MERISTEM PROTEIN
1ut7_A2e-29616017163NO APICAL MERISTEM PROTEIN
1ut4_B2e-29616017163NO APICAL MERISTEM PROTEIN
1ut4_A2e-29616017163NO APICAL MERISTEM PROTEIN
3swp_D2e-29616020166NAC domain-containing protein 19
3swp_C2e-29616020166NAC domain-containing protein 19
3swp_B2e-29616020166NAC domain-containing protein 19
3swp_A2e-29616020166NAC domain-containing protein 19
3swm_D2e-29616020166NAC domain-containing protein 19
3swm_C2e-29616020166NAC domain-containing protein 19
3swm_B2e-29616020166NAC domain-containing protein 19
3swm_A2e-29616020166NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011088915.10.0PREDICTED: NAC domain-containing protein 90
SwissprotQ9FMR32e-83NAC90_ARATH; NAC domain-containing protein 90
TrEMBLA0A022RAV31e-94A0A022RAV3_ERYGU; Uncharacterized protein (Fragment)
STRINGVIT_06s0080g00780.t014e-87(Vitis vinifera)
STRINGPGSC0003DMT4000677074e-87(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24942357
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.11e-84NAC domain containing protein 90